3.1: Amino Acids and Peptides (2025)

  1. Last updated
  2. Save as PDF
  • Page ID
    14927
  • \( \newcommand{\vecs}[1]{\overset { \scriptstyle \rightharpoonup} {\mathbf{#1}}}\)

    \( \newcommand{\vecd}[1]{\overset{-\!-\!\rightharpoonup}{\vphantom{a}\smash{#1}}} \)

    \( \newcommand{\id}{\mathrm{id}}\) \( \newcommand{\Span}{\mathrm{span}}\)

    ( \newcommand{\kernel}{\mathrm{null}\,}\) \( \newcommand{\range}{\mathrm{range}\,}\)

    \( \newcommand{\RealPart}{\mathrm{Re}}\) \( \newcommand{\ImaginaryPart}{\mathrm{Im}}\)

    \( \newcommand{\Argument}{\mathrm{Arg}}\) \( \newcommand{\norm}[1]{\| #1 \|}\)

    \( \newcommand{\inner}[2]{\langle #1, #2 \rangle}\)

    \( \newcommand{\Span}{\mathrm{span}}\)

    \( \newcommand{\id}{\mathrm{id}}\)

    \( \newcommand{\Span}{\mathrm{span}}\)

    \( \newcommand{\kernel}{\mathrm{null}\,}\)

    \( \newcommand{\range}{\mathrm{range}\,}\)

    \( \newcommand{\RealPart}{\mathrm{Re}}\)

    \( \newcommand{\ImaginaryPart}{\mathrm{Im}}\)

    \( \newcommand{\Argument}{\mathrm{Arg}}\)

    \( \newcommand{\norm}[1]{\| #1 \|}\)

    \( \newcommand{\inner}[2]{\langle #1, #2 \rangle}\)

    \( \newcommand{\Span}{\mathrm{span}}\) \( \newcommand{\AA}{\unicode[.8,0]{x212B}}\)

    \( \newcommand{\vectorA}[1]{\vec{#1}} % arrow\)

    \( \newcommand{\vectorAt}[1]{\vec{\text{#1}}} % arrow\)

    \( \newcommand{\vectorB}[1]{\overset { \scriptstyle \rightharpoonup} {\mathbf{#1}}}\)

    \( \newcommand{\vectorC}[1]{\textbf{#1}}\)

    \( \newcommand{\vectorD}[1]{\overrightarrow{#1}}\)

    \( \newcommand{\vectorDt}[1]{\overrightarrow{\text{#1}}}\)

    \( \newcommand{\vectE}[1]{\overset{-\!-\!\rightharpoonup}{\vphantom{a}\smash{\mathbf {#1}}}} \)

    \( \newcommand{\vecs}[1]{\overset { \scriptstyle \rightharpoonup} {\mathbf{#1}}}\)

    \( \newcommand{\vecd}[1]{\overset{-\!-\!\rightharpoonup}{\vphantom{a}\smash{#1}}} \)

    \(\newcommand{\avec}{\mathbf a}\) \(\newcommand{\bvec}{\mathbf b}\) \(\newcommand{\cvec}{\mathbf c}\) \(\newcommand{\dvec}{\mathbf d}\) \(\newcommand{\dtil}{\widetilde{\mathbf d}}\) \(\newcommand{\evec}{\mathbf e}\) \(\newcommand{\fvec}{\mathbf f}\) \(\newcommand{\nvec}{\mathbf n}\) \(\newcommand{\pvec}{\mathbf p}\) \(\newcommand{\qvec}{\mathbf q}\) \(\newcommand{\svec}{\mathbf s}\) \(\newcommand{\tvec}{\mathbf t}\) \(\newcommand{\uvec}{\mathbf u}\) \(\newcommand{\vvec}{\mathbf v}\) \(\newcommand{\wvec}{\mathbf w}\) \(\newcommand{\xvec}{\mathbf x}\) \(\newcommand{\yvec}{\mathbf y}\) \(\newcommand{\zvec}{\mathbf z}\) \(\newcommand{\rvec}{\mathbf r}\) \(\newcommand{\mvec}{\mathbf m}\) \(\newcommand{\zerovec}{\mathbf 0}\) \(\newcommand{\onevec}{\mathbf 1}\) \(\newcommand{\real}{\mathbb R}\) \(\newcommand{\twovec}[2]{\left[\begin{array}{r}#1 \\ #2 \end{array}\right]}\) \(\newcommand{\ctwovec}[2]{\left[\begin{array}{c}#1 \\ #2 \end{array}\right]}\) \(\newcommand{\threevec}[3]{\left[\begin{array}{r}#1 \\ #2 \\ #3 \end{array}\right]}\) \(\newcommand{\cthreevec}[3]{\left[\begin{array}{c}#1 \\ #2 \\ #3 \end{array}\right]}\) \(\newcommand{\fourvec}[4]{\left[\begin{array}{r}#1 \\ #2 \\ #3 \\ #4 \end{array}\right]}\) \(\newcommand{\cfourvec}[4]{\left[\begin{array}{c}#1 \\ #2 \\ #3 \\ #4 \end{array}\right]}\) \(\newcommand{\fivevec}[5]{\left[\begin{array}{r}#1 \\ #2 \\ #3 \\ #4 \\ #5 \\ \end{array}\right]}\) \(\newcommand{\cfivevec}[5]{\left[\begin{array}{c}#1 \\ #2 \\ #3 \\ #4 \\ #5 \\ \end{array}\right]}\) \(\newcommand{\mattwo}[4]{\left[\begin{array}{rr}#1 \amp #2 \\ #3 \amp #4 \\ \end{array}\right]}\) \(\newcommand{\laspan}[1]{\text{Span}\{#1\}}\) \(\newcommand{\bcal}{\cal B}\) \(\newcommand{\ccal}{\cal C}\) \(\newcommand{\scal}{\cal S}\) \(\newcommand{\wcal}{\cal W}\) \(\newcommand{\ecal}{\cal E}\) \(\newcommand{\coords}[2]{\left\{#1\right\}_{#2}}\) \(\newcommand{\gray}[1]{\color{gray}{#1}}\) \(\newcommand{\lgray}[1]{\color{lightgray}{#1}}\) \(\newcommand{\rank}{\operatorname{rank}}\) \(\newcommand{\row}{\text{Row}}\) \(\newcommand{\col}{\text{Col}}\) \(\renewcommand{\row}{\text{Row}}\) \(\newcommand{\nul}{\text{Nul}}\) \(\newcommand{\var}{\text{Var}}\) \(\newcommand{\corr}{\text{corr}}\) \(\newcommand{\len}[1]{\left|#1\right|}\) \(\newcommand{\bbar}{\overline{\bvec}}\) \(\newcommand{\bhat}{\widehat{\bvec}}\) \(\newcommand{\bperp}{\bvec^\perp}\) \(\newcommand{\xhat}{\widehat{\xvec}}\) \(\newcommand{\vhat}{\widehat{\vvec}}\) \(\newcommand{\uhat}{\widehat{\uvec}}\) \(\newcommand{\what}{\widehat{\wvec}}\) \(\newcommand{\Sighat}{\widehat{\Sigma}}\) \(\newcommand{\lt}{<}\) \(\newcommand{\gt}{>}\) \(\newcommand{\amp}{&}\) \(\definecolor{fillinmathshade}{gray}{0.9}\)

    Search Fundamentals of Biochemistry

    Learning Goals (ChatGPT o1, 1/25/25)

    Below is a series of learning goals designed to guide junior and senior biochemistry majors through the key concepts of protein structure, amino acid chemistry, and reactivity:

    • Understand the Role and Diversity of Proteins:

      • Describe the various functions of proteins (structural, regulatory, enzymatic, transport, etc.) and explain why proteins are considered the most functionally diverse macromolecules.
      • Recognize that proteins are linear polymers of alpha-amino acids linked by peptide bonds.
    • Comprehend Alpha Amino Acid Structure:

      • Identify the common structural features of an alpha amino acid (α-amino group, α-carboxylic acid, hydrogen, and a variable R-group).
      • Memorize the 20 naturally occurring amino acids along with their three-letter and one-letter abbreviations.
      • Explain how variations in the R-group confer different chemical properties (nonpolar, polar uncharged, acidic, and basic) to amino acids.
    • Master Peptide Bond Formation and Protein Primary Structure:

      • Describe the mechanism of peptide bond formation via nucleophilic attack and the release of water.
      • Illustrate the concept of primary protein structure as the linear sequence of amino acids and appreciate the enormous diversity of possible sequences.
    • Analyze Amino Acid Classification and Side Chain Characteristics:

      • Categorize amino acids based on their side chain properties (e.g., aliphatic vs. aromatic nonpolar, polar uncharged, acidic, and basic).
      • Discuss how side chain properties influence protein folding, stability, and function.
      • Interpret hydrophobicity (or hydropathy) scales (e.g., Kyte-Doolittle, Hopp-Woods) and relate these to protein topology (buried versus surface residues).
    • Grasp Stereochemistry and Chirality in Amino Acids:

      • Explain the concept of chirality and why all naturally occurring proteinogenic amino acids (except glycine) are L isomers.
      • Differentiate between the D/L nomenclature and the R/S system, and understand why the D/L system is preferred in biochemistry.
    • Apply Acid-Base Chemistry to Proteins:

      • Utilize the Henderson–Hasselbalch equation to predict the ionization state of amino acid side chains and terminal groups.
      • Interpret titration curves for amino acids and proteins, and calculate the isoelectric point (pI) of proteins based on the ionizable groups present.
    • Examine Chemical Reactivity of Amino Acid Side Chains:

      • Identify which side chains serve as hydrogen bond donors and acceptors, and explain their roles in catalysis and substrate binding.
      • Compare the nucleophilicity and basicity of key amino acid side chains (e.g., lysine, cysteine, histidine) and discuss factors (like electronegativity and steric effects) that influence reactivity.
      • Describe specific chemical reactions involving amino acid side chains, including acylation, Schiff base formation, and nucleophilic substitution reactions used in protein modification.
    • Explore Post-Translational Modifications (PTMs) and Their Biological Significance:

      • List common PTMs (e.g., phosphorylation, acetylation, glycosylation, oxidation) and explain how these modifications alter protein structure and function.
      • Understand how aberrant or deleterious PTMs (e.g., glycation, carbonylation) can lead to altered protein activity and contribute to disease processes.

    These learning goals are intended to help students integrate structural, chemical, and functional perspectives on proteins, preparing them for more advanced topics in enzymology, protein engineering, and molecular biology.

    Introduction

    Proteins are one of the most abundant organic molecules in living systems and have the most diverse range of functions of all macromolecules. Proteins may be structural, regulatory, contractile, or protective. They may serve in transport, storage, or membranes. They may betoxins or enzymes. Each cell in a living system may contain thousands of proteins, each with a unique function. Their structures, like their functions, vary greatly. They are all, however, polymers of alpha amino acids arranged in a linear sequence and connected by covalent bonds.

    Alpha Amino Acid Structure

    The major building blocks of proteins are called alpha (α) amino acids. As their name implies, they contain a carboxylic acid and an amine functional group. The alpha designation indicates that these two functional groups are separated by one carbon group. In addition to the amine and carboxylic acid, the alpha carbon is also attached to hydrogen and one additional group that can vary in size and length. In the diagram below, this group is designated as an R-group. Within living organisms, 20 common amino acids are used as protein building blocks. They differ from one another only in the R-group position. The fully protonated structure of an amino acid (at low pH) is shown in Figure \(\PageIndex{1}\).

    The twenty common naturally occurring amino acids contain alpha-carbon, an amino, carboxylic acid, and an R group (or side chain). The R group side chains may be either nonpolar, polar uncharged, or charged, depending on the functional group, the pH, and the pKa of any ionizable group in the side chain.

    Two other amino acids occasionally appear in proteins. One is selenocysteine, found in Archaea, eubacteria, and animals. Another is pyrrolysine, found in Archaea. Bacteria have been modified to incorporate two new amino acids, O-methyl-tyrosine and p-aminophenylalanine. The yeast strain Saccharomyces cerevisiae has been engineered to incorporate five new unnatural amino acids (using the TAG nonsense codon and new, modified tRNA and tRNA synthetases) with keto groups that allow chemical modifications to the protein. We will concentrate only on the 20 abundant, naturally occurring amino acids.

    Proteins are polymers of monomeric amino acids with an amidelink (also called a peptide bond) between the α-carboxylic group of one amino acidwith theα-amine of the next one. Figure \(\PageIndex{2}\) shows the twenty naturally occurring α-amino acids as they would appear internally within a protein sequence. The squiggles show the connecting amide/peptide bond betweenadjacent amino acids. Students often assume that the α-amino and α-carboxylic acid groups within a protein sequence are free and not part of the peptide bond. This figure should help in resolving that misconception. The three-letter andone-letter abbreviations of each amino acid are shown, as well as thetypical pKa values of side chains (R groups). It is important to memorize the three-letter and one-letter codes for the amino acids.

    3.1: Amino Acids and Peptides (4)3.1: Amino Acids and Peptides (5)

    Amino acids form polymers through a nucleophilic attack by the amino group of an amino acid at the electrophilic carbonyl carbon of the carboxyl group of another amino acid. The carboxyl group of the amino acid must first be activated to provide a better leaving group than OH-. The resulting link between the amino acids is an amide link which biochemists call a peptide bond. In this reaction, water is released. In a reverse reaction, the peptide bond can be cleaved by water (hydrolysis). This is illustrated in Figure \(\PageIndex{3}\).

    Proteins are polymers of twenty naturally occurring amino acids. In contrast, nucleic acids are polymers of just 4 different monomeric nucleotides. The sequence of a protein and its total length differentiate one protein from another. Just for an octapeptide, there are over 25 billion different possible arrangements of amino acids. Compare this to just 65536 oligonucleotides (4 different monomeric deoxynucleotides) of 8 monomeric units, an 8mer. Hence, the diversity of possible proteins is enormous.

    When two amino acids form an amide link, the resulting structure is called a dipeptide. Likewise, we can have tripeptides, tetrapeptides, and other polypeptides. At some point, when the structure is long enough, it is called a protein. The average molecular weight of proteins in yeast is about 50,000, with about 450 amino acids. The largest human protein might be titin, with a molecular weight of about 3 million (about 30,0000 amino acids). A new class of very small proteins (30 or fewer amino acids and perhaps better-named polypeptides) called smORFs (small open reading frames) have recently been discovered to have significant biological activity. These are encoded directly in the genome and are produced by the same processes that produce regular proteins (DNA transcription and RNA translation). They are not the result of selective cleavage of a larger protein into smaller peptide fragments.

    Figure \(\PageIndex{4}\) shows several ways to represent the structure of a polypeptide or protein, each showing differing amounts of information. Note that the atoms in the side chains are denoted alpha, beta, gamma, delta, epsilon ...

    3.1: Amino Acids and Peptides (7)

    Characteristics of Amino Acids

    The different R-groups have different characteristics based on the nature of atoms incorporated into the functional groups. Some R-groups predominantly contain carbon and hydrogen and are very nonpolar or hydrophobic. Others contain polar uncharged functional groups such as alcohols, amides, and thiols. A few amino acids are basic (containing amine functional groups) or acidic (containing carboxylic acid functional groups). These amino acid side chainscan form full charges and have ionic interactions. Each amino acid can be abbreviated using a three-letter and a one-letter code. Figure \(\PageIndex{5}\) shows groupings of the amino acids based on their side chain properties.

    3.1: Amino Acids and Peptides (8)

    Figure \(\PageIndex{5}\): Structure of the 20 Alpha Amino Acids used in Protein Synthesis. R-groups are shown in red,connected to the alpha-carbon by a red wedge bond.

    The above classification for a few amino acids is somewhat arbitrary, as described below. For example, cysteine is often buried in protein in a more hydrophobic environment.

    Nonpolar (Hydrophobic) Amino Acids

    The nonpolar amino acids can largely be subdivided into two more specific classes, the aliphatic amino acids and the aromatic amino acids. The aliphatic amino acids (glycine, alanine, valine, leucine, isoleucine, and proline) typically contain branched hydrocarbon chains, the simplest being glycine to the more complicated structures of leucine and valine. Proline is also classified as an aliphatic amino acid but contains special properties as the hydrocarbon chain has cyclized with the terminal amine, creating a unique 5-membered ring structure. As we will see in the next section covering primary structure, proline can significantly alter the 3-dimensional structure of the due to the structural rigidity of the ring structure when it is incorporated into the polypeptide chain and is commonly found in regions of the protein where folds or turns occur.

    As their name implies, thearomatic amino acids (phenylalanine, tyrosine, and tryptophan)contain an aromatic functional group within their structure, making them largely nonpolar and hydrophobic due to their high carbon/hydrogen content. However, it should be noted that hydrophobicity and hydrophilicity represent a sliding scale, and each of the different amino acids can have different physical and chemical properties depending on their structure. For example, the hydroxyl group in tyrosine increases its reactivity and solubility compared to phenylalanine.

    Methionine, one of the sulfur-containing amino acids,is usually classified as a nonpolar, hydrophobic amino acid. The terminal methyl group isa thioether, which generally cannot form a permanent dipole within the molecule and retains low solubility.

    Polar (Hydrophilic) Amino Acids

    The polar, hydrophilic amino acids can be subdivided into three major classes: the polar uncharged-, the acidic-, and the basic- functional groups. Within the polar uncharged class, the side chains contain heteroatoms (O, S, or N) capable of forming permanent dipoles within the R-group. These include the hydroxyl- and sulfhydryl-containing amino acids, serine, threonine, and cysteine, and the amide-containing amino acids, glutamine and asparagine. Two amino acids, glutamic acid (glutamate), and aspartic acid (aspartate) constitute the acidic amino acids and contain side chains with carboxylic acid functional groups capable of fully ionizing in solution. The basic amino acids, lysine, arginine, and histidine,contain amine functional groups that can be protonated to carry a full charge.

    Many amino acids with hydrophilic R-groups can participate within the active site of enzymes. An active site is the part of an enzyme that directly binds to a substrate and carries out a reaction. Protein-derived enzymes contain catalytic groups consisting of amino acid R-groups that promote the formation and degradation of bonds. The amino acids that play a significant role in the binding specificity of the active site are usually not adjacent to each other in the primary structure but form the active site as a result of folding in creating the tertiary structure, as you will see later in the chapter.

    Example \(\PageIndex{1}\)
    Thought Question: Tryptophan contains an amine functional group. Why isn't tryptophan basic?

    Answer: Tryptophan contains an indole ring structure with the amine functional group. However, due to the proximity of and electron-withdrawing nature of the aromatic ring structure, the lone pair of electrons on the nitrogen are unavailable to accept a proton. Instead, they form pi-bonds within several of the different resonance structures possible for the indole ring. Figure 2.3A shows four of the possible resonance structures for indole. Conversely, within the imidazole ring structure found in histidine, there are two nitrogen atoms, one of which is involved in the formation of resonance structures (Nitrogen #1 in Figure 2.3B) and cannot accept a proton, and the other (Nitrogen #3) that has a lone pair of electrons that is available to accept a proton.

    3.1: Amino Acids and Peptides (9)

    Exercise \(\PageIndex{1}\)

    Work It Out on Your Own:

    Given the example above, describe, using a chemical diagram, why the amide nitrogen atoms found in asparagine and glutamine are not basic.

    Answer

    The lone pair is delocalized into the peptide bond (different resonance structure), so it is unavailable for sharing.

    Recent Updates: 5/5/24

    Quantitative measures of amino acid polarity and hydrophobicity

    There are quantitative ways to determine the relative polarity ofan amino acid side chain, so it's not just a matter of visual inspection or a guess. Let's consider hydrophobicity or hydropathy scales. Most are based on the standard free energy oftransfer of a side chainfrom water to a nonpolar solvent. Each amino acid side chain is given a number that varies from a negative to a positive value. The Kyte-Doolittle and the Hopp-Woods hydropathy scales are the two commonly used scales, asshown in Table \(\PageIndex{1}\) below.

    Amino Acid

    Kyte-Doolittle

    Hopp-Woods

    Alanine

    1.8

    -0.5

    Arginine

    -4.5

    3.0

    Asparagine

    -3.5

    0.2

    Aspartic acid

    -3.5

    3.0

    Cysteine

    2.5

    -1.0

    Glutamine

    -3.5

    0.2

    Glutamic acid

    -3.5

    3.0

    Glycine

    -0.4

    0.0

    Histidine

    -3.2

    -0.5

    Isoleucine

    4.5

    -1.8

    Leucine

    3.8

    -1.8

    Lysine

    -3.9

    3.0

    Methionine

    1.9

    -1.3

    Phenylalanine

    2.8

    -2.5

    Proline

    -1.6

    0.0

    Serine

    -0.8

    0.3

    Threonine

    -0.7

    -0.4

    Tryptophan

    -0.9

    -3.4

    Tyrosine

    -1.3

    -2.3

    Valine

    4.2

    -1.5

    Table \(\PageIndex{1}\): Kyte-Doolittle and Hopp-Woods hydrophobicity values

    Note that the Hopp-Woods scale is more like a hydrophilicityscale since the more polar residues have more positive values. It was developed to locate likely antibody or other protein interaction sites on protein surfaces, which displaymore hydrophilic side chains.

    Some discrepancies existinwhich amino acid side chains are nonpolar between the Kyte-Doolittle values and Figure \(\PageIndex{5}\). The Kyte-Doolittle scale shows that glycine, the two large aromatics tyrosine and tryptophan, and proline are more polar than nonpolar and that cysteine is quite nonpolar.

    As we will see in subsequent sections, acontinuous stretch of amino acids found to have a high average hydrophobicity (low hydrophilicity) is probably buried in the interior of a protein away from the aqueous environment. Conversely, a continuous stretch with low hydrophobicity (high hydrophilicity) is likely buried in a protein or a membrane bilayer. Consider the example of the water-soluble bovine alpha-chymotrypsinogen, a 245 amino acid protein, whose sequence is shown below in single letter code.

    1 CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
    61 TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
    121 VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
    181 ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
    241 TLAAN

    Use the ExPasy Prot Scale server to produce hydrophobicity plots of the protein bovine α-chymotrypsinogen. Input the Uniprot numberP00766for the proteinor the sequence into the appropriate boxes. Select a length of continuous amino acids (called a window) of 7, and the program will calculate an average hydrophobicity for the "window." The window slides down the linear sequence, and a new value is calculated to determine a series of values for the entire sequence. Hydropathy plots(average score for the midpoint amino acid in the window) for chymotrypsinogen (window of seven consecutive residues) are shown in Figure \(\PageIndex{6}\) below. The Kyte-Doolittle scale (+ is hydrophobic) shows many stretches with high average values. The amino acids at those positions are likely buried in the protein's interior. The Hoop-Woods value (+ is hydrophilic) shows stretches with high average values. These amino acids are likely on the surface exposed to water. The two plots are complementary to each other.

    Kyte-Doolittle (7 aa window) Hopp-Woods (7 aa window)
    3.1: Amino Acids and Peptides (10) 3.1: Amino Acids and Peptides (11)

    Figure \(\PageIndex{6}\): Kyte-Doolittle and Hopp-Woods plots for bovine α-chymotrypsinogen

    Amino Acid Stereochemistry

    The amino acids are all chiralexcept glycine, whose side chain is H. A chiral moleculeis not superimposable with its mirror image. Like left and right hands that have a thumb and fingers in the same order but are mirror images and not the same, chiral molecules have the same things attached in the same order but are mirror images and not the same. The mirror image versions of chiral molecules have physical properties that are nearly identical to one another, making it very difficult to tell them apart from one another or to separate them. Because of this, they are given a special stereoisomer name called enantiomers, and the compounds themselves are given the same name! These molecules differ in how they rotate plane-polarized light and react with and interact with biological molecules. Molecules that rotate light in the right-handed direction are called dextrorotary and are given a small "d"letter designation. Molecules that rotate light in the left-handed direction are called levorotary and are given a small "l"letter designation to distinguish one enantiomer from the other. Biochemists also use the older nomenclature oflarge "L" and "D" to characterize the 3D stereochemistry of the amino acids. All naturally occurring proteins from all living organisms consist of L amino acids based on their structural similarities to L-glyceraldehyde.

    Again, the d- and l-designations are specific terms for how a molecule rotates plane-polarized light. It does not denote the absolute stereo configuration of a molecule.Anabsolute configurationrefers to the spatial arrangement of the atoms of a chiral molecular entity (or group) and its modern stereochemical description, e.g.,RorS, referring toRectusorSinister, respectively.Absolute configurations for a chiral molecule (in pure form) are often determined by X-ray crystallography. Alternative techniques are optical rotatory dispersion, vibrational circular dichroism, chiral shift reagents in proton NMR, and Coulomb explosion imaging. When the absolute configuration is known, the assignment of R or S is based on the Cahn–Ingold–Prelog priority rules. The absolute stereochemistry is related to L-glyceraldehyde, as shown below in Figure \(\PageIndex{6}\).

    All naturally occurring amino acids in proteins are L, which corresponds to the S isomer, except cysteine. As shown in the bottom left of Figure \(\PageIndex{7}\)below, the absolute configuration of the amino acids can be shown with the H pointed to the rear, the COOH groups pointing out to the left, the R group to the right, and the NH3 group upwards. You can remember this with the mnemonic "CORN".

    Why does Biochemistry still use D and L for sugars and amino acids? This explanation (taken from a website that may not be available anymore, so no reference is available) seems reasonable.

    "In addition, however, chemists often need to define a configuration unambiguously in the absence of any reference compound, and for this purpose, the alternative (R,S) system is ideal, as it uses priority rules to specify configurations. These rules sometimes produce absurd results when applied to biochemical molecules. For example, as we have seen, all of the common amino acids are L, because they all have exactly the same structure, including the position of the R group if we just write the R group as R. However, they do not all have the same configuration in the (R, S) system: L-cysteine is also (R)-cysteine, but all the other L-amino acids are (S), but this just reflects the human decision to give a sulfur atom a higher priority than a carbon atom and does not reflect a real difference in configuration. Worse problems can sometimes arise in substitution reactions: sometimes, inversion of configuration can result in no change in the (R) or (S) prefix, and sometimes, retention of configuration can result in a change of prefix.

    It follows that it is not just conservatism or failure to understand the (R,S) system that causes biochemists to continue with D and L: it is just that the DL system fulfills their needs much better. As mentioned, chemists also use D and L when appropriate to their needs. The explanation given above of why the (R, S) system is little used in biochemistry is thus almost the exact opposite of reality. This system is the only practical way of unambiguously representing the stereochemistry of complicated molecules with several asymmetric centers, but it is inconvenient with regular series of molecules like amino acids and simple sugars."

    If you are told to draw the correct stereochemistry of a molecule with 1 chiral C (S isomer, for example) and are given the substituents, you could do so easily following the R, S priority rules. However, how would you draw the correct isomer for the L isomer of the amino acid alanine? You couldn't do it without prior knowledge of the absolute configuration of the related molecule, L glyceraldehyde, or unless you remembered the anagram CORN. However, this disadvantage is more than made up for by the fact that different L amino acids with the same absolute stereochemistry might be labeled R or S, making this nomenclature unappealing to biochemists.

    Amino Acid Charges

    Monomeric amino acids have an alpha-amino group and a carboxyl group, both of which may be protonated or deprotonated, and an R group, some of which may be protonated or deprotonated. When protonated, the amino group has a +1 charge, and the carboxyl group has a zero charge. When deprotonated, the amino group has no charge, while the carboxyl group has a -1 charge. The R groups that can be protonated/deprotonated include Lys, Arg, and His, which have a + 1 charge when protonated, and Glu and Asp (carboxylic acids), Tyr and Ser (alcohols) and Cys (thiol), which have 0 charges when protonated. Of course, when the amino acids are linked by peptide bonds (amide link), the alpha N and the carboxyl C are in an amide link and are not charged.

    However, the amino group of the N-terminal amino acid and the carboxyl group of the C-terminal amino acid of a protein may be charged. The Henderson-Hasselbalch equation allows us to determine the charge state of any ionizable group knowing the pKa of the group. Write each functional group capable of being deprotonated as an acid, HA, and the deprotonated form as A. The charge of HA and A will be determined by the functional group and the Henderson-Hasselbalch equation from Chapter 2.2.

    \begin{equation}
    \mathrm{pH}=\mathrm{p} K_{\mathrm{a}}+\log \frac{\left[\mathrm{A}^{-}\right]}{[\mathrm{HA}]}
    \end{equation}

    The titration curve for a single ionizable acid with different pKa values is shown below.

    At the curve's inflection point, pH = pKa, the system is most resistant to changes in pH when addingeither acid or base. At this pH, [HA]=[A-].

    The properties of a protein will be determined partly by whether the side chain functional groups, the N terminal, and the C terminal, are charged or not. The HH equation tells us that this will depend on the pH and the pKa of the functional group.

    • If the pH is 2 units below the pKa, the HH equation becomes -2 = log A/HA, or .01 = A/HA. This means the functional group will be about 99% protonated (with either 0 or +1 charge, depending on the functional group).
    • If the pH is 2 units above the pKa, the HH equation becomes 2 = log A/HA, or 100 = A/HA. Therefore, the functional group will be 99% deprotonated.
    • If the pH = pKa, the HH equation becomes 0 = log A/HAor 1 = A/HA. Therefor,e the functional group will be 50% deprotonated.

    From these simple examples, we have derived the +2 rule. This rule is used to quickly determine protonation, and hence charge state, and is extremely important to know (and easy to derive). Titration curves for Gly (no ionizable) side chain, Glu (carboxylic acid side chain), and Lys (amine side chain) are shown in Figure \(\PageIndex{8}\). You should be able to associate various sections of these curves with the titration of specific ionizable groups in the amino acids.

    3.1: Amino Acids and Peptides (13)

    New 5/16/23:Download this Excel spreadsheet forTitration Curves for a Triprotic Acid. It hasadjustable scroll bars to change pKa values.

    Buffer Review

    The Henderson-Hasselbalch equation is also useful in calculating the composition of buffer solutions. Remember that buffer solutions are composed of a weak acid and its conjugate base. Consider the equilibrium for a weak acid, like acetic acid, and its conjugate base, acetate:

    \[\ce{CH3CO2H + H2O <=> H3O^{+} + CH3CO2^{-}} \nonumber \]

    If the buffer solution contains equal concentrations of acetic acid and acetate, the pH of the solution is:

    or pH = pKa + log [A]/[HA] = 4.7 + log 1 = 4.7

    A look at the titration curve for the carboxyl group of Gly (see above) shows that when the pH = pKa, the slope of the curve (i.e. the change in pH on addition of base or acid) is at a minimum. As a general rule of thumb, buffer solutions can be made for a weak acid/base in the range of +/- 1 pH unit from the pKa of the weak acids. At the pH = pKa, the buffer solution best resists adding either an acid or a base and has its greatest buffering ability. The weak acid can react with the added strong base to form the weak conjugate base, and the conjugate base can react with added strong acid to form the weak acid (as shown below), so pH changes with the addition of strong acid and base are minimized.

    • addition of a strong base produces a weak conjugate base: CH3CO2H + OH- ↔ CH3CO2- + H2O
    • addition of strong acid produces weak acid: H3O+ + CH3CO2 → CH3CO2H + H2O

    There are two simple ways to make a buffered solution. Consider an acetic acid/acetate buffer solution.

    • make equal molar solutions of acetic acid and sodium acetate and mix them, monitoring pH with a pH meter, until the desired pH is reached (+/- 1 unit from the pKa).
    • take an acetic acid solution and add NaOH at substoichiometric amounts until the desired pH is reached (+/- 1 unit from the pKa). In this method, you are forming the conjugate base, acetate, with the addition of NaOH:

    CH3CO2H + OH- → CH3CO2- + H2O

    Isoelectric Point

    What happens if you have many ionizable groups in a single molecule, as is the case with a polypeptide or a protein? Consider a protein. At a pH of 2, all ionizable groups would be protonated, and the overall charge of the protein would be positive. (Remember, when carboxylic acid side chains are protonated, their net charge is 0.) As the pH is increased, the most acidic groups will start to deprotonate, and the net charge will become less positive. At high pH, all the ionizable groups will become deprotonated in the strong base, and the overall charge of the protein will be negative. At some pH, then, the net charge will be 0. This pH is called the isoelectric point (pI). The pI can be determined by averaging the pKa values of the two closest groups straddling the pI. One of the online problems will address this in more detail.

    Remember that pKa is a measure of the equilibrium constant for the reaction. And, of course, you remember that ΔGo = -RT ln Keq. Therefore, pKa is independent of concentration and depends only on the intrinsic stability of reactants with respect to the products. This is true only AT A GIVEN SET OF CONDITIONS, SUCH AS T, P, AND SOLVENT CONDITIONS.

    Consider, for example, acetic acid, which in aqueous solution has a pKa of about 4.7. It is a weak acid, which dissociates only slightly to form H+ (in water the hydronium ion, H3O+, is formed) and acetate (Ac-). These ions are moderately stable in water but reassociate readily to form the starting product. The pKa of acetic acid in 80% ethanol is 6.87. This can be accounted for by the decrease in stability of the charged products, which are less shielded from each other by the less polar ethanol. Ethanol has a lower dielectric constant than water. The pKa increases to 10.32 in 100% ethanol and a whopping 130 in air!

    Because amino acids are zwitterions, and several also contain the potential for ionization within their R-groups, their charge state in vivo, and thus, their reactivity can vary depending on the pH, temperature, and solvation status of the local microenvironment in which they are located. Table \(\PageIndex{2}\) shows the standard pKa values for the amino acids and can be used to predict their ionization/charge status and their resulting peptides/proteins.

    3.1: Amino Acids and Peptides (14)

    Table \(\PageIndex{2}\): Summary of pKas of amino acids

    However, it should be noted that the solvation status in the microenvironment of an amino acid can alter the relative pKa values of these functional groups and provide unique reactive properties within the active sites of enzymes. A more in-depth discussion of the effects of desolvation will be given in Chapter 6, discussing enzyme reaction mechanisms.

    Introduction to Amino Acid Reactivity

    You should be able to identify which side chains contain H bond donors and acceptors. Likewise, some are acids and bases. You should know the approximate pKas of the side chains andthe N and C terminal groups. Three of the amino acid side chains (Trp, Tyr, and Phe) contribute significantly to the UV absorption of a protein at 280 nm. This section will deal predominantly with the chemical reactivity of the side chains, which is important in understanding the properties of the proteins. Many of the side chains are nucleophiles. Nucleophilicity is a measures of how rapidly molecules with lone pairs of electrons can react in nucleophilic substitution reactions. It correlates with basicity, which measures the extent to which a molecule with lone pairs can react with an acid (Bronsted or Lewis). The properties of the atom that holds the lone pair are important in determining both nucleophilicity and basicity. In both cases, the atom must be willing to share its unbonded electron pair. If the atoms holding the nonbonded pair are more electronegative, they will be less likely to share electrons, and that molecule will be a poorer nucleophile (nu:) and weaker base.Using these ideas, it should be clear that RNH2 is a better nucleophile than ROH, OH- is better than H2O, and RSH is better than H2O. In the latter case, S is bigger, and its electron cloud is more polarizable - hence, it is more reactive. The important side chain nucleophiles (in order from most to least nucleophilic) are Cys (RSH, pKa 8.5-9.5), His (pKa 6-7), Lys (pKa 10.5) and Ser (ROH, pKa 13). The side chain of serine is generally no more reactive than ethanol. It is a potent nucleophile in a certain class of proteins (proteases, for example) whendeprotonated. The amino group of lysine is a potent nucleophile only when deprotonated.

    An understanding of the chemical reactivity of the various R group side chains of the amino acids in a protein is important since chemical reagents that react specifically with a given amino acid side chain can be used to:

    • identify the presence of the amino acids in unknown proteins or
    • determine if a given amino acid is critical for the structure or function of the protein. For example, suppose a reagent that covalently interacts with only Lys is found to inhibit the protein's function. In that case, a lysine might be considered important in the protein's catalytic activity.

    Figure \(\PageIndex{9}\) summarizes nucleophilic addition and substitution at carbonyl carbons.

    The rest of the section will summarize the chemistry of the side chains of reactive amino acids. Historically, the function of a given amino acid in a protein has been studied by reacting it with side chain-specific chemical modifying agents. In addition, some side chains are covalently modified after they are synthesized in vivo (post-translational modification—see below).

    Reactions of Lysine

    Figure \(\PageIndex{10}\) shows the reaction of lysine with anhydrides and ethylacetimidate.

    • reacts with anhydrides in a nucleophilic substitution reaction (acylation).
    • reacts reversibly with methylmaleic anhydride (also called citraconic anhydride) in a nucleophilic substitution reaction.
    • reacts with high specificity and yields toward ethylacetimidate in a nucleophilic substitution reaction (ethylacetimidate is like ethylacetate only with an imido group replacing the carbonyl oxygen). Ethanol leaves as the amidino group forms. (has two N -i.e. din - attached to the C)
    3.1: Amino Acids and Peptides (16)

    Figure \(\PageIndex{11}\) shows a second set of common reactions of lysine, including those used to attach a chromophore or a fluorescent label to the side chain.

    • reacts with O-methylisourea in a nucleophilic substitution reaction. with the expulsion of methanol to form a guanidino group (has 3 N attached to C, nidi)
    • reacts with fluorodinitrobenzene (FDNB or Sanger's reagent) or trinitrobenzenesulfonate (TNBS, as we saw with the reaction with phosphatidylethanolamine) in a nucleophilic aromatic substitution reaction to form 2,4-DNP-lysine or TNB-lysine.
    • reacts with Dimethylaminonapthelenesulfonylchloride (Dansyl Chloride) in a nucleophilic substitution reaction.
    3.1: Amino Acids and Peptides (17)

    3.1: Amino Acids and Peptides (18)Figure \(\PageIndex{12}\) shows a final common reaction we will encounter: the formation of an imine or Schiff base on the reaction of lysine with an aldehyde or ketone.

    • reacts with high specificity toward aldehydes to form imines (Schiff bases), which can be reduced with sodium borohydride or cyanoborohydride to form a secondary amine.
    3.1: Amino Acids and Peptides (19)

    Reactions of Cysteine

    Cysteine is a potent nucleophile often linked to another Cys to form a covalent disulfide bond.

    Figure \(\PageIndex{13}\) shows common reagents used in the lab to label free Cys side chains. These reagents are used to alter Cys side chains to determine if they have functional significance in a protein (such as an active nucleophile in an enzyme-catalyzed reaction).

    • reacts with iodoacetic acid in an SN2 reaction, adding a carboxymethyl group to the S.
    • reacts with iodoacetamide in an SN2 reaction, adding a carboxyamidomethyl group to S.
    • reacts with N-ethylmaleimide in an addition reaction to the double bond
    3.1: Amino Acids and Peptides (20)

    Sulfur is directly below oxygen in the periodic table, and, in analogy to water, sulfur-containing amino acids are found in different redox states, as illustrated in Figure \(\PageIndex{14}\).

    3.1: Amino Acids and Peptides (21)

    Cystine Chemistry

    Two cysteine side chains can covalently interact in a protein to produce a disulfide (RS-SR) named cystine. Just as HOOH (hydrogen peroxide) is more oxidized than HOH (O in H2O2 has an oxidation number of 1- while the O in H2O has an oxidation number of -2), RSSR is the oxidized form (S oxidation number -1), and RSH is the reduced form (S oxidation number -2) of thiols. Their oxidation numbers are analogous since O and S are both in Group 6 of the periodic table and are more electronegative than C.

    Cystine can react with a free sulfhydryl (RSH) in a thermodynamically non-challenging disulfideexchangereaction, which, when conducted with excess free sulfhydryls, results in the reduction of cystine in the protein, as shown in Figure \(\PageIndex{15}\).

    3.1: Amino Acids and Peptides (22)

    Figure \(\PageIndex{15}\): Disulfide interchange and reduction of protein disulfides

    This reaction is often used in the lab to quantify the amount of free cysteine side chains in a protein using Ellman's reagent, as shown in Figure \(\PageIndex{16}\).

    3.1: Amino Acids and Peptides (23)

    The 2-nitro-5-thiobennzoic acid anion leaving group absorbs at 412 nm, making quantitation easy. However, unless the protein is unfolded to expose all the cysteines, only surface and not buried free cysteines will be labeled.

    When a protein folds, two Cys side chains might approach each other and form an intra-chain disulfide bond. Likewise, two Cys side chains on separate proteins might approach each other and form an inter-chain disulfide. For analysis of the protein structure, disulfides are typically cleaved, and then the chains are separatedThe disulfides can be cleaved by reducing agents such as beta-mercaptoethanol, dithiothreitol, tris (2-carboxyethyl) phosphine (TCEP), or by oxidizing agents like performic acid, which further oxidizes the disulfide to separate cysteic acids. Three common reagents used in disulfide cleavage reactions in the lab are shown in Figure \(\PageIndex{17}\).

    3.1: Amino Acids and Peptides (24)

    3.1: Amino Acids and Peptides (25)The reaction for beta-mercaptoethanol (BME) and performic acid is shown in Figure \(\PageIndex{18}\)below.

    3.1: Amino Acids and Peptides (26)

    Figure \(\PageIndex{19}\) shows the reaction for dithiothreitol (DTT). Note that it forms a stable cyclohexane-like ring, making this reaction very thermodynamically favored. It does not require as much excess DTT as the reaction with BME.

    3.1: Amino Acids and Peptides (27)

    The reaction with tris (2-carboxyethyl) phosphine (TCEP) is not a disulfide interchange reaction, as is shown in Figure \(\PageIndex{20}\).

    3.1: Amino Acids and Peptides (28)

    Cells maintain a reducing environment using many "reducing" agents, such as the tripeptide gamma-Glu-Cys-Gly (glutathione). Hence intracellular proteins usually do not contain disulfides, which are abundant in extracellular proteins (such as those found in blood), or in certain organelles such as the endoplasmic reticulum and mitochondrial intermembrane space where disulfides can be introduced.

    Sulfur redox chemistry is very important biologically. As described above, the sulfur in cysteine is redox-active. Hence, it can exist in various states, depending on the local redox environment and the presence of oxidizing and reducing agents. A potent oxidizing agent that can be made in cells is hydrogen peroxide, which can lead to more drastic and irreversible chemical modifications to the Cys side chains. Suppose a reactive Cys is important to protein function. In that case, the function of the protein can be modulated (sometimes reversibly, sometimes irreversibly) with various oxidizing agents, as shown in Figure \(\PageIndex{21}\).

    3.1: Amino Acids and Peptides (29)

    Reactions of Histidine

    Histidine is one of the most important bases at physiological pH. Remember from introductory chemistry that for any acid/conjugate base pair, the pKa and pKb of the acidand base are related by this expression:

    pKa + pKb = 14

    Table \(\PageIndex{3}\) below shows the pKa and pKb of three amino acids.

    amino acid pKa pKb
    Histidine 6.5 7.5
    Lysine 10.5 3.5
    Arginine 12.5 1.5

    Table \(\PageIndex{3}\): pKa and pKb values for three amino acid side chains

    Thedeprotonated forms of Lys and Arg with lower pKbs are much stronger bases than the deprotonated form of His, so at physiologicalpH, they would always be protonated (unless their local environment lowers their pKa and pKb values). In contrast, His exists in both protonated and deprotonated states at physiological pH, so it can readily gain a proton and act as a general base in reactions.

    His can exist as two tautomers, as shown in Figure \(\PageIndex{22}\). NMR studies show that in model peptides, the proton predominantly is on the ε2, N3, or tele N in the imidazole ring, as it has a pKa 0.6 units higher than δ1, N1, or pro N.

    3.1: Amino Acids and Peptides (30)

    The nitrogen atom in a secondary amine might be expected to be a stronger nucleophile than a primary amine through electron release to that N in a secondary amine. Opposing this effect is the steric hindrance by the two attached Cs of the N on attach on an electrophile. However, in His, this steric effect is minimized since the 2Cs are restrained by the ring. With a pKa of about 6.5, this amino acid is one of the strongest available bases at physiological pH (7.0). Hence, it can often cross-react with many reagents used to modify Lys side chains. His reacts with reasonably high selectivity with diethylpyrocarbonateas shown in Figure \(\PageIndex{23}\).

    3.1: Amino Acids and Peptides (31)

    In vivo Post-Translational Modification of Amino Acids

    Amino acids in naturally occurring proteins are also subjected to chemical modifications within cells. These modifications alter the properties of the amino acid, which can alter the structure and function of the protein. Most chemical modifications made to proteins within cells occur after the protein is synthesized in a process called translation. The resulting chemical changes are termed post-translational modifications. Several are shown in Figure \(\PageIndex{24}\). Simple acid/base reactions are included, but these are not considered examples of post-translational modifications.

    3.1: Amino Acids and Peptides (32)

    There are 100s of PTMs, and many are part of an elaborate system within a cell to respond to both external (hormones, neurotransmitters, nutrients, metabolites) and internal chemical signals. The PTMs (like phosphorylation, acetylation, etc.) and their removal by enzymes are part of an elaborate cell signaling system that we will explore in great detail in Chapter 28. However, not all PTMs are benign. Examples include glycation, oxidation, citrullination, and carbonylation of protein side chains. These are often increased during periods of inflammatory stress (both acute and chronic). These modified proteins are degraded within the cell to short peptides that retain the chemical modification. Unfortunately, these can be recognized by the immune system as foreign, which leads to an immune response against self and autoimmune disease. One potentially deleterious PTM is the carboxyethylation of cysteine, catalyzed by the enzyme cystathionine β-synthase as shown in Figure \(\PageIndex{25}\) below.

    3.1: Amino Acids and Peptides (33)

    Figure \(\PageIndex{25}\): Carboxyethylation of cysteine

    The product is very similar to the carboxymethylation of cysteine shown in Figure 13 above. The modifying reagent, 3-hydroxypropionic acids, is a metabolite released by microbes found in the gut. This modification has been shown to produce an autoimmune response in the disease ankylosing spondylitis.

    Summary

    This chapter provides an extensive overview of proteins, their building blocks, and the chemical principles that govern their structure and function. It begins by emphasizing that proteins are not only among the most abundant macromolecules in living systems, but also the most functionally diverse. Proteins serve many roles—including structural support, catalysis, regulation, transport, and defense—and their diversity arises from the linear polymerization of alpha-amino acids linked via peptide bonds.

    Key topics include:

    • Alpha-Amino Acid Structure and Protein Primary Structure:
      Every protein is composed of 20 naturally occurring alpha-amino acids, each sharing a common backbone (an α-amino group, an α-carboxyl group, and a hydrogen atom) and a unique R-group that defines its chemical properties. The chapter clarifies the process of peptide bond formation (and hydrolysis) through nucleophilic attack, and it dispels common misconceptions about the free nature of the terminal groups in a protein chain.

    • Amino Acid Side Chain Properties:
      The diverse chemical nature of proteins is largely due to the variability of the amino acid side chains, which can be classified as nonpolar (hydrophobic), polar uncharged, acidic, or basic. These classifications are critical for understanding protein folding, stability, and function. The chapter introduces hydropathy scales, such as the Kyte-Doolittle and Hopp-Woods scales, to quantitatively assess the relative hydrophobicity or hydrophilicity of side chains, providing insight into protein topology.

    • Stereochemistry and Chirality:
      Except for glycine, all amino acids are chiral and naturally occur as L isomers in proteins. The chapter contrasts the D/L nomenclature with the R/S system and explains why biochemists favor the former, particularly when describing the stereochemistry of amino acids in the context of protein structure.

    • Acid-Base Chemistry and Ionization:
      The ionizable groups on amino acids, including the α-amino, α-carboxyl, and various side chains, determine the overall charge and reactivity of proteins. The Henderson–Hasselbalch equation is introduced as a tool to predict the protonation state of these groups under varying pH conditions, leading to the concept of the isoelectric point (pI) — the pH at which a protein has no net charge.

    • Chemical Reactivity of Side Chains:
      Beyond structural roles, the chemical reactivity of amino acid side chains is central to protein function. The chapter details how key side chains—such as those of lysine, cysteine, and histidine—participate in nucleophilic reactions, form covalent modifications (e.g., Schiff bases), and are targeted by specific chemical reagents. This reactivity is foundational for both enzyme catalysis and experimental methods used to probe protein structure and function.

    • Post-Translational Modifications (PTMs):
      The chapter concludes by discussing PTMs, which are chemical modifications that occur after protein synthesis. These modifications, including phosphorylation, acetylation, glycosylation, and oxidation, can dramatically alter a protein's activity, stability, and interactions. While many PTMs are critical for normal cellular signaling, aberrant modifications may contribute to disease.

    Overall, the chapter integrates structural biology with chemical reactivity, providing a comprehensive framework that links the primary structure of proteins to their three-dimensional architecture and dynamic functions in the cell. This foundation is essential for understanding advanced topics in enzymology, protein engineering, and molecular regulation.

    3.1: Amino Acids and Peptides (2025)

    References

    Top Articles
    Latest Posts
    Recommended Articles
    Article information

    Author: Tyson Zemlak

    Last Updated:

    Views: 6318

    Rating: 4.2 / 5 (63 voted)

    Reviews: 86% of readers found this page helpful

    Author information

    Name: Tyson Zemlak

    Birthday: 1992-03-17

    Address: Apt. 662 96191 Quigley Dam, Kubview, MA 42013

    Phone: +441678032891

    Job: Community-Services Orchestrator

    Hobby: Coffee roasting, Calligraphy, Metalworking, Fashion, Vehicle restoration, Shopping, Photography

    Introduction: My name is Tyson Zemlak, I am a excited, light, sparkling, super, open, fair, magnificent person who loves writing and wants to share my knowledge and understanding with you.